MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001355

Record overview

MGPD IDMGP001355
Gene ID2948
SpeciesHomo sapiens (Human)
Gene Nameglutathione S-transferase mu 4
Gene Symbol GSTM4
SynonymsGTM4; GSTM4-4;
Alternate namesglutathione S-transferase Mu 4; GST class-mu 4; GST-Mu2; GTS-Mu2; S-(hydroxyalkyl)glutathione lyase M4; glutathione S-alkyltransferase M4; glutathione S-aralkyltransferase M4; glutathione S-aryltransferase M4; glutathione S-transferase M4;
Chromosome1
Map Location1p13.3
EC Number2.5.1.18
SummaryCytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. Multiple transcript variants, each encoding a distinct protein isoform, have been identified. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for GSTM4

Proteins

glutathione S-transferase Mu 4 isoform 1
Refseq ID:NP_000841
Protein GI:4504179
UniProt ID:Q03013
mRNA ID:NM_000850
Length:218
RefSeq Status:
MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDIL
ENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKS
SRFLPKPLYTRVAVWGNK
 
glutathione S-transferase Mu 4 isoform 2
Refseq ID:NP_671489
Protein GI:23065557
UniProt ID:Q03013
mRNA ID:NM_147148
Length:195
RefSeq Status:
MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDIL
ENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEVSCGIM
 
  logo