MGP Database

MGP001448

Record overview

MGPD IDMGP001448
Gene ID3113
SpeciesHomo sapiens (Human)
Gene Namemajor histocompatibility complex, class II, DP alpha 1
Gene Symbol HLA-DPA1
SynonymsPLT1; HLADP; HLASB; DP(W3); DP(W4); HLA-DP1A;
Alternate namesHLA class II histocompatibility antigen, DP alpha 1 chain; HLA-SB alpha chain; MHC class II DP3-alpha; MHC class II HLA-DPA1 antigen; MHC class II antigen; Primed lymphocyte test-1;
Chromosome6
Map Location6p21.3
SummaryHLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for HLA-DPA1

Proteins

HLA class II histocompatibility antigen, DP alpha 1 chain precursor
Refseq ID:NP_291032
Protein GI:24797074
UniProt ID:P20036
mRNA ID:NM_033554
Length:260
RefSeq Status:
MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNN
LNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWG
LDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL
 
sig_peptide: 1..28
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P20036.1)
calculated_mol_wt: 3283
peptide sequence: 
MRPEDRMFHIRAVILRALSLAFLLSLRG

mat_peptide: 29..260
product: HLA class II histocompatibility antigen, DP alpha 1 chain
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P20036.1)
calculated_mol_wt: 26116
peptide sequence: 
AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPV
ELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCAL
GLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL sig_peptide: 1..28 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P20036.1) calculated_mol_wt: 3283 peptide sequence: MRPEDRMFHIRAVILRALSLAFLLSLRG mat_peptide: 29..260 product: HLA class II histocompatibility antigen, DP alpha 1 chain experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P20036.1) calculated_mol_wt: 26116 peptide sequence: AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPV
ELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCAL
GLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL sig_peptide: 1..28 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P20036.1) calculated_mol_wt: 3283 peptide sequence: MRPEDRMFHIRAVILRALSLAFLLSLRG mat_peptide: 29..260 product: HLA class II histocompatibility antigen, DP alpha 1 chain experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P20036.1) calculated_mol_wt: 26116 peptide sequence: AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPV
ELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCAL
GLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL
 
HLA class II histocompatibility antigen, DP alpha 1 chain precursor
Refseq ID:NP_001229453
Protein GI:335883185
UniProt ID:P20036
mRNA ID:NM_001242524
Length:260
RefSeq Status:
Protein sequence is identical to GI:24797074 (mRNA isoform)
 
sig_peptide: 1..28
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P20036.1)
calculated_mol_wt: 3283
peptide sequence: 
MRPEDRMFHIRAVILRALSLAFLLSLRG

mat_peptide: 29..260
product: HLA class II histocompatibility antigen, DP alpha 1 chain
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P20036.1)
calculated_mol_wt: 26116
peptide sequence: 
AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPV
ELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCAL
GLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL
 
HLA class II histocompatibility antigen, DP alpha 1 chain precursor
Refseq ID:NP_001229454
Protein GI:335883187
UniProt ID:P20036
mRNA ID:NM_001242525
Length:260
RefSeq Status:
Protein sequence is identical to GI:24797074 (mRNA isoform)
 
sig_peptide: 1..28
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P20036.1)
calculated_mol_wt: 3283
peptide sequence: 
MRPEDRMFHIRAVILRALSLAFLLSLRG

mat_peptide: 29..260
product: HLA class II histocompatibility antigen, DP alpha 1 chain
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P20036.1)
calculated_mol_wt: 26116
peptide sequence: 
AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPV
ELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCAL
GLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL sig_peptide: 1..28 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P20036.1) calculated_mol_wt: 3283 peptide sequence: MRPEDRMFHIRAVILRALSLAFLLSLRG mat_peptide: 29..260 product: HLA class II histocompatibility antigen, DP alpha 1 chain experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P20036.1) calculated_mol_wt: 26116 peptide sequence: AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPV
ELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCAL
GLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL
 
  logo