MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001552

Record overview

MGPD IDMGP001552
Gene ID3417
SpeciesHomo sapiens (Human)
Gene Nameisocitrate dehydrogenase 1 (NADP+), soluble
Gene Symbol IDH1
SynonymsIDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26;
Alternate namesisocitrate dehydrogenase [NADP] cytoplasmic; NADP(+)-specific ICDH; NADP-dependent isocitrate dehydrogenase, cytosolic; NADP-dependent isocitrate dehydrogenase, peroxisomal; epididymis luminal protein 216; epididymis secretory protein Li 26; oxalosuccinate decarboxylase;
Chromosome2
Map Location2q33.3
EC Number1.1.1.42
SummaryIsocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2013]
OrthologsView orthologs and multiple alignments for IDH1

Proteins

isocitrate dehydrogenase [NADP] cytoplasmic
Refseq ID:NP_005887
Protein GI:28178825
UniProt ID:O75874
mRNA ID:NM_005896
Length:414
RefSeq Status:
MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIR
NILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMA
LSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDK
LGENLKIKLAQAKL
 
isocitrate dehydrogenase [NADP] cytoplasmic
Refseq ID:NP_001269316
Protein GI:538917681
UniProt ID:O75874
mRNA ID:NM_001282387
Length:414
RefSeq Status:
Protein sequence is identical to GI:28178825 (mRNA isoform)
 
isocitrate dehydrogenase [NADP] cytoplasmic
Refseq ID:NP_001269315
Protein GI:538917488
UniProt ID:O75874
mRNA ID:NM_001282386
Length:414
RefSeq Status:
Protein sequence is identical to GI:28178825 (mRNA isoform)
 
  logo