MGP Database

MGP001611

Record overview

MGPD ID	MGP001611
Gene ID	3567
Species	Homo sapiens (Human)
Gene Name	interleukin 5
Gene Symbol	IL5
Synonyms	EDF; TRF; IL-5;
Alternate names	interleukin-5; B-cell differentiation factor I; T-cell replacing factor; colony-stimulating factor, eosinophil; eosinophil differentiation factor;
Chromosome	5
Map Location	5q31.1
Summary	This gene encodes a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. The encoded cytokine plays a major role in the regulation of eosinophil formation, maturation, recruitment and survival. The increased production of this cytokine may be related to pathogenesis of eosinophil-dependent inflammatory diseases. This cytokine functions by binding to its receptor, which is a heterodimer, whose beta subunit is shared with the receptors for interleukine 3 (IL3) and colony stimulating factor 2 (CSF2/GM-CSF). This gene is located on chromosome 5 within a cytokine gene cluster which includes interleukin 4 (IL4), interleukin 13 (IL13), and CSF2 . This gene, IL4, and IL13 may be regulated coordinately by long-range regulatory elements spread over 120 kilobases on chromosome 5q31. [provided by RefSeq, Jul 2013]
Orthologs	View orthologs and multiple alignments for IL5

Proteins

interleukin-5 precursor

Refseq ID:	NP_000870
Protein GI:	4504671
UniProt ID:	P05113
mRNA ID:	NM_000879
Length:	134
RefSeq Status:

`MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDG QKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES`

sig_peptide: 1..19
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2107
peptide sequence: 
MRMLLHLSLLALGAAYVYA

mat_peptide: 20..134
product: interleukin-5
calculated_mol_wt: 13149
peptide sequence: 
IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYL
QEFLGVMNTEWIIES