MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001722

Record overview

MGPD IDMGP001722
Gene ID3761
SpeciesHomo sapiens (Human)
Gene Namepotassium channel, inwardly rectifying subfamily J, member 4
Gene Symbol KCNJ4
SynonymsHIR; HRK1; IRK3; HIRK2; IRK-3; Kir2.3;
Alternate namesinward rectifier potassium channel 4; hippocampal inward rectifier potassium channel; inward rectifier K(+) channel Kir2.3; inward rectifier K+ channel Kir2.3; potassium channel, inwardly rectifying subfamily J member 4; potassium inwardly-rectifying channel, subfamily J, member 4;
Chromosome22
Map Location22q13.1
SummarySeveral different potassium channels are known to be involved with electrical signaling in the nervous system. One class is activated by depolarization whereas a second class is not. The latter are referred to as inwardly rectifying K+ channels, and they have a greater tendency to allow potassium to flow into the cell rather than out of it. This asymmetry in potassium ion conductance plays a key role in the excitability of muscle cells and neurons. The protein encoded by this gene is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for KCNJ4

Proteins

inward rectifier potassium channel 4
Refseq ID:NP_690607
Protein GI:23110984
UniProt ID:P48050
mRNA ID:NM_152868
Length:445
RefSeq Status:
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPA
AGGGGAAPVAPKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKL
CLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT
TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAG
LGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI
 
inward rectifier potassium channel 4
Refseq ID:NP_004972
Protein GI:4826798
UniProt ID:P48050
mRNA ID:NM_004981
Length:445
RefSeq Status:
Protein sequence is identical to GI:23110984 (mRNA isoform)
 
  logo