MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001747

Record overview

MGPD IDMGP001747
Gene ID3790
SpeciesHomo sapiens (Human)
Gene Namepotassium voltage-gated channel, modifier subfamily S, member 3
Gene Symbol KCNS3
SynonymsKV9.3;
Alternate namespotassium voltage-gated channel subfamily S member 3; Shab-related delayed-rectifier K+ channel alpha subunit 3; delayed-rectifier K(+) channel alpha subunit 3; potassium voltage-gated channel delayed-rectifier protein S3; potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3; voltage-gated potassium channel protein Kv9.3; voltage-gated potassium channel subunit Kv9.3;
Chromosome2
Map Location2p24
SummaryVoltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. The protein encoded by this gene is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins. This gene belongs to the S subfamily of the potassium channel family. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2013]
OrthologsView orthologs and multiple alignments for KCNS3

Proteins

potassium voltage-gated channel subfamily S member 3
Refseq ID:NP_002243
Protein GI:25952108
UniProt ID:Q9BQ31
mRNA ID:NM_002252
Length:491
RefSeq Status:
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFC
QEIEYWGINELFIDSCCSNRYQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIV
AMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAVRLAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVAL
PITIIFNKFSKYYQKQKDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHTFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTAK
 
potassium voltage-gated channel subfamily S member 3
Refseq ID:NP_001269357
Protein GI:539846921
UniProt ID:Q9BQ31
mRNA ID:NM_001282428
Length:491
RefSeq Status:
Protein sequence is identical to GI:25952108 (mRNA isoform)
 
  logo