MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001755

Record overview

MGPD IDMGP001755
Gene ID3802
SpeciesHomo sapiens (Human)
Gene Namekiller cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1
Gene Symbol KIR2DL1
SynonymsNKAT; NKAT1; p58.1; CD158A; KIR221; NKAT-1; KIR-K64;
Alternate nameskiller cell immunoglobulin-like receptor 2DL1; CD158 antigen-like family member A; MHC class I NK cell receptor; killer Ig receptor; killer inhibitory receptor 2-2-1; natural killer-associated transcript 1; p58 NK cell inhibitory receptor NKR-K6; p58 NK receptor CL-42/47.11; p58 killer cell inhibitory receptor KIR-K64; p58 natural killer cell receptor clones CL-42/47.11; p58.1 MHC class-I-specific NK receptor;
Chromosome19
Map Location19q13.4
SummaryKiller cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for KIR2DL1

Proteins

killer cell immunoglobulin-like receptor 2DL1 precursor
Refseq ID:NP_055033
Protein GI:110611923
UniProt ID:P43626
mRNA ID:NM_014218
Length:348
RefSeq Status:
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRC
YGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFG
SFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
 
sig_peptide: 1..21
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P43626.1)
calculated_mol_wt: 2270
peptide sequence: 
MSLLVVSMACVGFFLLQGAWP

mat_peptide: 22..348
product: Killer cell immunoglobulin-like receptor 2DL1
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P43626.1)
calculated_mol_wt: 36328
peptide sequence: 
HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIV
IIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVT
GNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQR
PKTPPTDIIVYTELPNAESRSKVVSCP
 
  logo