MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001806

Record overview

MGPD IDMGP001806
Gene ID3937
SpeciesHomo sapiens (Human)
Gene Namelymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa)
Gene Symbol LCP2
SynonymsSLP76; SLP-76;
Alternate nameslymphocyte cytosolic protein 2; 76 kDa tyrosine phosphoprotein; SH2 domain-containing leukocyte protein of 76 kDa; SH2 domain-containing leukocyte protein of 76kD; SLP-76 tyrosine phosphoprotein;
Chromosome5
Map Location5q35.1
SummarySLP-76 was originally identified as a substrate of the ZAP-70 protein tyrosine kinase following T cell receptor (TCR) ligation in the leukemic T cell line Jurkat. The SLP-76 locus has been localized to human chromosome 5q33 and the gene structure has been partially characterized in mice. The human and murine cDNAs both encode 533 amino acid proteins that are 72% identical and comprised of three modular domains. The NH2-terminus contains an acidic region that includes a PEST domain and several tyrosine residues which are phosphorylated following TCR ligation. SLP-76 also contains a central proline-rich domain and a COOH-terminal SH2 domain. A number of additional proteins have been identified that associate with SLP-76 both constitutively and inducibly following receptor ligation, supporting the notion that SLP-76 functions as an adaptor or scaffold protein. Studies using SLP-76 deficient T cell lines or mice have provided strong evidence that SLP-76 plays a positive role in promoting T cell development and activation as well as mast cell and platelet function. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for LCP2

Proteins

lymphocyte cytosolic protein 2
Refseq ID:NP_005556
Protein GI:5031855
UniProt ID:Q13094
mRNA ID:NM_005565
Length:533
RefSeq Status:
MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEE
DNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPP
PAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLPKIQKPPLPPTTERHERSSPL
PGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPL
PLPNKPRPPSPAEEENSLNEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLRGKEDFLSVSD
IIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP
 
  logo