MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001854

Record overview

MGPD IDMGP001854
Gene ID4086
SpeciesHomo sapiens (Human)
Gene NameSMAD family member 1
Gene Symbol SMAD1
SynonymsBSP1; JV41; BSP-1; JV4-1; MADH1; MADR1;
Alternate namesmothers against decapentaplegic homolog 1; MAD homolog 1; MAD, mothers against decapentaplegic homolog 1; Mad-related protein 1; SMAD, mothers against DPP homolog 1; TGF-beta signaling protein 1; mothers against DPP homolog 1; transforming growth factor-beta signaling protein 1; transforming growth factor-beta-signaling protein 1;
Chromosome4
Map Location4q31
SummaryThe protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for SMAD1

Proteins

mothers against decapentaplegic homolog 1
Refseq ID:NP_001003688
Protein GI:51173727
UniProt ID:Q15797
mRNA ID:NM_001003688
Length:465
RefSeq Status:
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSH
HELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSS
STYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGF
ETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
 
mothers against decapentaplegic homolog 1
Refseq ID:NP_005891
Protein GI:5174509
UniProt ID:Q15797
mRNA ID:NM_005900
Length:465
RefSeq Status:
Protein sequence is identical to GI:51173727 (mRNA isoform)
 
  logo