MGP Database

MGP002117

Record overview

MGPD ID	MGP002117
Gene ID	4852
Species	Homo sapiens (Human)
Gene Name	neuropeptide Y
Gene Symbol	NPY
Synonyms	PYY4;
Alternate names	pro-neuropeptide Y; prepro-neuropeptide Y;
Chromosome	7
Map Location	7p15.1
Summary	This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014]
Orthologs	View orthologs and multiple alignments for NPY

Proteins

pro-neuropeptide Y preproprotein

Refseq ID:	NP_000896
Protein GI:	4505449
UniProt ID:	P01303
mRNA ID:	NM_000905
Length:	97
RefSeq Status:

`MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW`

sig_peptide: 1..28
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2798
peptide sequence: 
MLGNKRLGLSGLTLALSLLVCLGALAEA

mat_peptide: 29..64
product: pro-neuropeptide Y
experiment: DESCRIPTION:antimicrobial peptide[PMID: 9756788]
calculated_mol_wt: 4273
peptide sequence: 
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY