MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002298

Record overview

MGPD IDMGP002298
Gene ID5300
SpeciesHomo sapiens (Human)
Gene Namepeptidylprolyl cis/trans isomerase, NIMA-interacting 1
Gene Symbol PIN1
SynonymsDOD; UBL5;
Alternate namespeptidyl-prolyl cis-trans isomerase NIMA-interacting 1; PPIase Pin1; protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1; rotamase Pin1;
Chromosome19
Map Location19p13
EC Number5.2.1.8
SummaryPeptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jun 2011]
OrthologsView orthologs and multiple alignments for PIN1

Proteins

peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
Refseq ID:NP_006212
Protein GI:5453898
UniProt ID:Q13526
mRNA ID:NM_006221
Length:163
RefSeq Status:
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGE
EDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
 
  logo