MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002329

Record overview

MGPD IDMGP002329
Gene ID5350
SpeciesHomo sapiens (Human)
Gene Namephospholamban
Gene Symbol PLN
SynonymsPLB; CMD1P; CMH18;
Alternate namescardiac phospholamban;
Chromosome6
Map Location6q22.1
SummaryThe protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for PLN

Proteins

cardiac phospholamban
Refseq ID:NP_002658
Protein GI:4505887
UniProt ID:P26678
mRNA ID:NM_002667
Length:52
RefSeq Status:
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
 
  logo