MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKREDVSAGEDCGPLPEGGPEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKRELTGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2763 peptide sequence: MPRSCCSRSGALLLALLLQASMEVRG mat_peptide: 27..102 product: N-terminal peptide calculated_mol_wt: 8469 peptide sequence: WCLESSQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQ mat_peptide: 77..87 product: melanotropin gamma exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 1514 peptide sequence: YVMGHFRWDRF mat_peptide: 105..134 product: joining peptide calculated_mol_wt: 3006 peptide sequence: EDVSAGEDCGPLPEGGPEPRSDGAKPGPRE mat_peptide: 138..176 product: adrenocorticotropin calculated_mol_wt: 4541 peptide sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF mat_peptide: 138..150 product: melanotropin alpha experiment: DESCRIPTION:antimicrobial peptide[PMID: 25140322] exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 1624 peptide sequence: SYSMEHFRWGKPV mat_peptide: 156..176 product: corticotropin-like intermediary peptide exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 2310 peptide sequence: PVKVYPNGAEDESAEAFPLEF mat_peptide: 179..267 product: lipotropin beta calculated_mol_wt: 9806 peptide sequence: ELTGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE mat_peptide: 179..234 product: lipotropin gamma exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 6075 peptide sequence: ELTGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKD mat_peptide: 217..234 product: melanotropin beta exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 2204 peptide sequence: DEGPYRMEHFRWGSPPKD mat_peptide: 237..267 product: beta-endorphin exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 3465 peptide sequence: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE mat_peptide: 237..263 product: beta-endorphin (1-27) exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 3023 peptide sequence: YGGFMTSEKSQTPLVTLFKNAIIKNAY mat_peptide: 237..241 product: met-enkephalin exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 574 peptide sequence: YGGFM
sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2763 peptide sequence: MPRSCCSRSGALLLALLLQASMEVRG mat_peptide: 27..102 product: N-terminal peptide calculated_mol_wt: 8469 peptide sequence: WCLESSQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQ mat_peptide: 77..87 product: melanotropin gamma exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 1514 peptide sequence: YVMGHFRWDRF mat_peptide: 105..134 product: joining peptide calculated_mol_wt: 3006 peptide sequence: EDVSAGEDCGPLPEGGPEPRSDGAKPGPRE mat_peptide: 138..176 product: adrenocorticotropin calculated_mol_wt: 4541 peptide sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF mat_peptide: 138..150 product: melanotropin alpha experiment: DESCRIPTION:antimicrobial peptide[PMID: 25140322] exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 1624 peptide sequence: SYSMEHFRWGKPV mat_peptide: 156..176 product: corticotropin-like intermediary peptide exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 2310 peptide sequence: PVKVYPNGAEDESAEAFPLEF mat_peptide: 179..267 product: lipotropin beta calculated_mol_wt: 9806 peptide sequence: ELTGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE mat_peptide: 179..234 product: lipotropin gamma exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 6075 peptide sequence: ELTGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKD mat_peptide: 217..234 product: melanotropin beta exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 2204 peptide sequence: DEGPYRMEHFRWGSPPKD mat_peptide: 237..267 product: beta-endorphin exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 3465 peptide sequence: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE mat_peptide: 237..263 product: beta-endorphin (1-27) exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 3023 peptide sequence: YGGFMTSEKSQTPLVTLFKNAIIKNAY mat_peptide: 237..241 product: met-enkephalin exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 574 peptide sequence: YGGFM sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2763 peptide sequence: MPRSCCSRSGALLLALLLQASMEVRG mat_peptide: 27..102 product: N-terminal peptide calculated_mol_wt: 8469 peptide sequence: WCLESSQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQ mat_peptide: 77..87 product: melanotropin gamma exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 1514 peptide sequence: YVMGHFRWDRF mat_peptide: 105..134 product: joining peptide calculated_mol_wt: 3006 peptide sequence: EDVSAGEDCGPLPEGGPEPRSDGAKPGPRE mat_peptide: 138..176 product: adrenocorticotropin calculated_mol_wt: 4541 peptide sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF mat_peptide: 138..150 product: melanotropin alpha experiment: DESCRIPTION:antimicrobial peptide[PMID: 25140322] exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 1624 peptide sequence: SYSMEHFRWGKPV mat_peptide: 156..176 product: corticotropin-like intermediary peptide exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 2310 peptide sequence: PVKVYPNGAEDESAEAFPLEF mat_peptide: 179..267 product: lipotropin beta calculated_mol_wt: 9806 peptide sequence: ELTGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE mat_peptide: 179..234 product: lipotropin gamma exception: alternative processing calculated_mol_wt: 6075 peptide sequence: ELTGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKD mat_peptide: 217..234 product: melanotropin beta exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 2204 peptide sequence: DEGPYRMEHFRWGSPPKD mat_peptide: 237..267 product: beta-endorphin exception: alternative processing calculated_mol_wt: 3465 peptide sequence: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE mat_peptide: 237..263 product: beta-endorphin (1-27) exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 3023 peptide sequence: YGGFMTSEKSQTPLVTLFKNAIIKNAY mat_peptide: 237..241 product: met-enkephalin exception: alternative processing note: occurs in cells other than corticotroph cells of the anterior pituitary calculated_mol_wt: 574 peptide sequence: YGGFM