MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002435

Record overview

MGPD IDMGP002435
Gene ID5594
SpeciesHomo sapiens (Human)
Gene Namemitogen-activated protein kinase 1
Gene Symbol MAPK1
SynonymsERK; p38; p40; p41; ERK2; ERT1; ERK-2; MAPK2; PRKM1; PRKM2; P42MAPK; p41mapk; p42-MAPK;
Alternate namesmitogen-activated protein kinase 1; MAP kinase 1; MAP kinase 2; MAP kinase isoform p42; MAPK 2; extracellular signal-regulated kinase 2; mitogen-activated protein kinase 2; protein tyrosine kinase ERK2;
Chromosome22
Map Location22q11.21
EC Number2.7.11.24
SummaryThis gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq, Jan 2014]
OrthologsView orthologs and multiple alignments for MAPK1

Proteins

mitogen-activated protein kinase 1
Refseq ID:NP_620407
Protein GI:20986531
UniProt ID:P28482
mRNA ID:NM_138957
Length:360
RefSeq Status:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKD
VYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIML
NSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
 
mitogen-activated protein kinase 1
Refseq ID:NP_002736
Protein GI:66932916
UniProt ID:P28482
mRNA ID:NM_002745
Length:360
RefSeq Status:
Protein sequence is identical to GI:20986531 (mRNA isoform)
 
  logo