MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002502

Record overview

MGPD IDMGP002502
Gene ID5717
SpeciesHomo sapiens (Human)
Gene Nameproteasome (prosome, macropain) 26S subunit, non-ATPase, 11
Gene Symbol PSMD11
SynonymsS9; Rpn6; p44.5;
Alternate names26S proteasome non-ATPase regulatory subunit 11; 26S proteasome regulatory subunit 9; 26S proteasome regulatory subunit RPN6; 26S proteasome regulatory subunit S9; 26S proteasome regulatory subunit p44.5;
Chromosome17
Map Location17q11.2
SummaryThe 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the proteasome subunit S9 family that functions as a non-ATPase subunit of the 19S regulator and is phosphorylated by AMP-activated protein kinase. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]
OrthologsView orthologs and multiple alignments for PSMD11

Proteins

26S proteasome non-ATPase regulatory subunit 11
Refseq ID:NP_002806
Protein GI:28872725
UniProt ID:O00231
mRNA ID:NM_002815
Length:422
RefSeq Status:
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDME
AATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAI
YCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAA
LETIQNMSKVVDSLYNKAKKLT
 
26S proteasome non-ATPase regulatory subunit 11
Refseq ID:NP_001257411
Protein GI:394953908
UniProt ID:O00231
mRNA ID:NM_001270482
Length:422
RefSeq Status:
Protein sequence is identical to GI:28872725 (mRNA isoform)
 
  logo