MGP Database

MGP002560

Record overview

MGPD ID	MGP002560
Gene ID	5880
Species	Homo sapiens (Human)
Gene Name	ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
Gene Symbol	RAC2
Synonyms	Gx; EN-7; HSPC022; p21-Rac2;
Alternate names	ras-related C3 botulinum toxin substrate 2; Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP-binding protein Rac2); small G protein;
Chromosome	22
Map Location	22q13.1
Summary	This gene encodes a member of the Ras superfamily of small guanosine triphosphate (GTP)-metabolizing proteins. The encoded protein localizes to the plasma membrane, where it regulates diverse processes, such as secretion, phagocytosis, and cell polarization. Activity of this protein is also involved in the generation of reactive oxygen species. Mutations in this gene are associated with neutrophil immunodeficiency syndrome. There is a pseudogene for this gene on chromosome 6. [provided by RefSeq, Jul 2013]
Orthologs	View orthologs and multiple alignments for RAC2

Proteins

ras-related C3 botulinum toxin substrate 2

Refseq ID:	NP_002863
Protein GI:	4506381
UniProt ID:	P15153
mRNA ID:	NM_002872
Length:	192
RefSeq Status:

`MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPE VRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL`

mat_peptide: 1..189
product: Ras-related C3 botulinum toxin substrate 2
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P15153.1)
calculated_mol_wt: 21116
peptide sequence: 
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPE
VRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRAC