MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002742

Record overview

MGPD IDMGP002742
Gene ID6281
SpeciesHomo sapiens (Human)
Gene NameS100 calcium binding protein A10
Gene Symbol S100A10
Synonyms42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG;
Alternate namesprotein S100-A10; S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S100 calcium-binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); annexin II ligand, calpactin I, light polypeptide; annexin II tetramer (AIIt) p11 subunit; calpactin I light chain; calpactin-1 light chain; cellular ligand of annexin II;
Chromosome1
Map Location1q21
SummaryThe protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for S100A10

Proteins

protein S100-A10
Refseq ID:NP_002957
Protein GI:4506761
UniProt ID:P60903
mRNA ID:NM_002966
Length:97
RefSeq Status:
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
 
  logo