MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002743

Record overview

MGPD IDMGP002743
Gene ID6283
SpeciesHomo sapiens (Human)
Gene NameS100 calcium binding protein A12
Gene Symbol S100A12
Synonymsp6; CAGC; CGRP; MRP6; CAAF1; MRP-6; ENRAGE;
Alternate namesprotein S100-A12; EN-RAGE; S100 calcium-binding protein A12 (calgranulin C); calcitermin; calcium-binding protein in amniotic fluid 1; calgranulin C; calgranulin-C; extracellular newly identified RAGE-binding protein; migration inhibitory factor-related protein 6; neutrophil S100 protein;
Chromosome1
Map Location1q21
SummaryThe protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity. [provided by RefSeq, Nov 2014]
OrthologsView orthologs and multiple alignments for S100A12

Proteins

protein S100-A12
Refseq ID:NP_005612
Protein GI:5032059
UniProt ID:P80511
mRNA ID:NM_005621
Length:92
RefSeq Status:
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
 
mat_peptide: 78..92
product: calcitermin
experiment: DESCRIPTION:antimicrobial peptide[PMID: 11522286]
calculated_mol_wt: 1689
peptide sequence: 
VAIALKAAHYHTHKE
 
  logo