MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002744

Record overview

MGPD IDMGP002744
Gene ID6285
SpeciesHomo sapiens (Human)
Gene NameS100 calcium binding protein B
Gene Symbol S100B
SynonymsNEF; S100; S100-B; S100beta;
Alternate namesprotein S100-B; S-100 calcium-binding protein, beta chain; S-100 protein subunit beta; S100 calcium-binding protein, beta (neural);
Chromosome21
Map Location21q22.3
SummaryThe protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for S100B

Proteins

protein S100-B
Refseq ID:NP_006263
Protein GI:5454034
UniProt ID:P04271
mRNA ID:NM_006272
Length:92
RefSeq Status:
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
 
  logo