MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002842

Record overview

MGPD IDMGP002842
Gene ID6500
SpeciesHomo sapiens (Human)
Gene NameS-phase kinase-associated protein 1
Gene Symbol SKP1
SynonymsOCP2; p19A; EMC19; SKP1A; OCP-II; TCEB1L;
Alternate namesS-phase kinase-associated protein 1; OCP-2; RNA polymerase II elongation factor-like protein OCP2; SIII; cyclin A/CDK2-associated p19; cyclin A/CDK2-associated protein p19; cyclin-A/CDK2-associated protein p19; organ of Corti protein 2; organ of Corti protein II; p19skp1; transcription elongation factor B polypeptide 1-like;
Chromosome5
Map Location5q31
SummaryThis gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for SKP1

Proteins

S-phase kinase-associated protein 1 isoform a
Refseq ID:NP_008861
Protein GI:25777711
UniProt ID:P63208
mRNA ID:NM_006930
Length:160
RefSeq Status:
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTL
FELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
 
S-phase kinase-associated protein 1 isoform b
Refseq ID:NP_733779
Protein GI:25777713
UniProt ID:P63208
mRNA ID:NM_170679
Length:163
RefSeq Status:
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTL
FELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
 
  logo