MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003021

Record overview

MGPD IDMGP003021
Gene ID6818
SpeciesHomo sapiens (Human)
Gene Namesulfotransferase family, cytosolic, 1A, phenol-preferring, member 3
Gene Symbol SULT1A3
SynonymsSTM; HAST; HAST3; M-PST; ST1A3; ST1A5; TL-PST; ST1A3/ST1A4;
Alternate namessulfotransferase 1A3; aryl sulfotransferase 1A3/1A4; catecholamine-sulfating phenol sulfotransferase; dopamine-specific sulfotransferase; monoamine-sulfating phenosulfotransferase; phenol sulfotransferase 1A5; placental estrogen sulfotransferase; sulfokinase; thermolabile (monoamine, M form) phenol sulfotransferase;
Chromosome16
Map Location16p11.2
EC Number2.8.2.1
SummarySulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Read-through transcription exists between this gene and the upstream SLX1A (SLX1 structure-specific endonuclease subunit homolog A) gene that encodes a protein containing GIY-YIG domains. [provided by RefSeq, Nov 2010]
OrthologsView orthologs and multiple alignments for SULT1A3

Proteins

sulfotransferase 1A3
Refseq ID:NP_808220
Protein GI:29550921
UniProt ID:P0DMM9
mRNA ID:NM_177552
Length:295
RefSeq Status:
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTP
PPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENP
KREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
 
  logo