MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003055

Record overview

MGPD IDMGP003055
Gene ID6881
SpeciesHomo sapiens (Human)
Gene NameTAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa
Gene Symbol TAF10
SynonymsTAF2A; TAF2H; TAFII30;
Alternate namestranscription initiation factor TFIID subunit 10; STAF28; TAF(II)30; TAFII-30; TATA box binding protein (TBP)-associated factor, RNA polymerase II, H, 30kD; transcription initiation factor TFIID 30 kD subunit; transcription initiation factor TFIID 30 kDa subunit;
Chromosome11
Map Location11p15.3
SummaryInitiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the small subunits of TFIID that is associated with a subset of TFIID complexes. Studies with human and mammalian cells have shown that this subunit is required for transcriptional activation by the estrogen receptor, for progression through the cell cycle, and may also be required for certain cellular differentiation programs. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for TAF10

Proteins

transcription initiation factor TFIID subunit 10
Refseq ID:NP_006275
Protein GI:5454106
UniProt ID:Q12962
mRNA ID:NM_006284
Length:218
RefSeq Status:
MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLP
SAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDL
TPALSEYGINVKKPHYFT
 
  logo