MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003718

Record overview

MGPD IDMGP003718
Gene ID8851
SpeciesHomo sapiens (Human)
Gene Namecyclin-dependent kinase 5, regulatory subunit 1 (p35)
Gene Symbol CDK5R1
Synonymsp23; p25; p35; CDK5R; NCK5A; CDK5P35; p35nck5a;
Alternate namescyclin-dependent kinase 5 activator 1; CDK5 activator 1; TPKII regulatory subunit; cyclin-dependent kinase 5 regulatory subunit 1; neuronal CDK5 activator; regulatory partner for CDK5 kinase; tau protein kinase II 23kDa subunit;
Chromosome17
Map Location17q11.2
SummaryThe protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for CDK5R1

Proteins

cyclin-dependent kinase 5 activator 1
Refseq ID:NP_003876
Protein GI:4502737
UniProt ID:Q15078
mRNA ID:NM_003885
Length:307
RefSeq Status:
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQ
PPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPAN
VVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR
 
  logo