MGP Database

MGP004185

Record overview

MGPD ID	MGP004185
Gene ID	10268
Species	Homo sapiens (Human)
Gene Name	receptor (G protein-coupled) activity modifying protein 3
Gene Symbol	RAMP3
Alternate names	receptor activity-modifying protein 3; CRLR activity-modifying protein 3; calcitonin receptor-like receptor activity modifying protein 3; calcitonin-receptor-like receptor activity-modifying protein 3; receptor (calcitonin) activity modifying protein 3; receptor activity modifying protein 3; receptor-activity-modifying protein 3;
Chromosome	7
Map Location	7p13-p12
Summary	The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP3) protein, CRLR functions as an adrenomedullin receptor. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for RAMP3

Proteins

receptor activity-modifying protein 3 precursor

Refseq ID:	NP_005847
Protein GI:	5032023
UniProt ID:	O60896
mRNA ID:	NM_005856
Length:	148
RefSeq Status:

`METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQF FSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL`

sig_peptide: 1..23
calculated_mol_wt: 2465
peptide sequence: 
METGALRRPQLLPLLLLLCGGCP

mat_peptide: 24..148
product: receptor activity-modifying protein 3
calculated_mol_wt: 14072
peptide sequence: 
RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLI
VIPVVLTVAMAGLVVWRSKRTDTLL