MGP Database

MGP004287

Record overview

MGPD ID	MGP004287
Gene ID	10563
Species	Homo sapiens (Human)
Gene Name	chemokine (C-X-C motif) ligand 13
Gene Symbol	CXCL13
Synonyms	BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13;
Alternate names	C-X-C motif chemokine 13; B-cell chemoattractant; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); B-lymphocyte chemoattractant; CXC chemokine BLC; b cell-attracting chemokine 1; b lymphocyte chemoattractant; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); small-inducible cytokine B13;
Chromosome	4
Map Location	4q21
Summary	B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq, Oct 2014]
Orthologs	View orthologs and multiple alignments for CXCL13

Proteins

C-X-C motif chemokine 13 precursor

Refseq ID:	NP_006410
Protein GI:	5453577
UniProt ID:	O43927
mRNA ID:	NM_006419
Length:	109
RefSeq Status:

`MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLP VPVFKRKIP`

sig_peptide: 1..22
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2365
peptide sequence: 
MKFISTSLLLMLLVSSLSPVQG

mat_peptide: 23..109
product: C-X-C motif chemokine 13
experiment: DESCRIPTION:antimicrobial peptide[PMID: 12949249]
calculated_mol_wt: 10317
peptide sequence: 
VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP