MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP004682

Record overview

MGPD IDMGP004682
Gene ID23468
SpeciesHomo sapiens (Human)
Gene Namechromobox homolog 5
Gene Symbol CBX5
SynonymsHP1; HP1A; HEL25;
Alternate nameschromobox protein homolog 5; HP1 alpha homolog; HP1-ALPHA; HP1Hs alpha; antigen p25; chromobox homolog 5 (HP1 alpha homolog, Drosophila); epididymis luminal protein 25; heterochromatin protein 1 homolog alpha; heterochromatin protein 1-alpha;
Chromosome12
Map Location12q13.13
SummaryThis gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for CBX5

Proteins

chromobox protein homolog 5
Refseq ID:NP_001120793
Protein GI:188035908
UniProt ID:P45973
mRNA ID:NM_001127321
Length:191
RefSeq Status:
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD
IKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
 
chromobox protein homolog 5
Refseq ID:NP_036249
Protein GI:6912292
UniProt ID:P45973
mRNA ID:NM_012117
Length:191
RefSeq Status:
Protein sequence is identical to GI:188035908 (mRNA isoform)
 
chromobox protein homolog 5
Refseq ID:NP_001120794
Protein GI:188035910
UniProt ID:P45973
mRNA ID:NM_001127322
Length:191
RefSeq Status:
Protein sequence is identical to GI:188035908 (mRNA isoform)
 
  logo