MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP005216

Record overview

MGPD IDMGP005216
Gene ID51616
SpeciesHomo sapiens (Human)
Gene NameTAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
Gene Symbol TAF9B
SynonymsDN7; DN-7; TAF9L; TAFII31L; TFIID-31;
Alternate namestranscription initiation factor TFIID subunit 9B; TAF9-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa; TBP-associated factor 9L; neuronal cell death-related protein 7; transcription associated factor TAFII31L; transcription initiation factor IID, 31kD subunit; transcription-associated factor TAFII31L;
ChromosomeX
Map LocationXq13.1-q21.1
SummaryInitiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits of TFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also have distinct roles in the transcriptional regulatory process. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for TAF9B

Proteins

transcription initiation factor TFIID subunit 9B
Refseq ID:NP_057059
Protein GI:20070280
UniProt ID:Q9HBM6
mRNA ID:NM_015975
Length:251
RefSeq Status:
MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKN
QTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPA
TTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM
 
  logo