MGP Database

MGP000073

Record overview

MGPD ID	MGP000073
Gene ID	133
Species	Homo sapiens (Human)
Gene Name	adrenomedullin
Gene Symbol	ADM
Synonyms	AM; PAMP;
Alternate names	ADM; preproadrenomedullin; proadrenomedullin N-20 terminal peptide;
Chromosome	11
Map Location	11p15.4
Summary	The protein encoded by this gene is a preprohormone which is cleaved to form two biologically active peptides, adrenomedullin and proadrenomedullin N-terminal 20 peptide. Adrenomedullin is a 52 aa peptide with several functions, including vasodilation, regulation of hormone secretion, promotion of angiogenesis, and antimicrobial activity. The antimicrobial activity is antibacterial, as the peptide has been shown to kill E. coli and S. aureus at low concentration. [provided by RefSeq, Aug 2014]
Orthologs	View orthologs and multiple alignments for ADM

Proteins

ADM precursor

Refseq ID:	NP_001115
Protein GI:	4501945
UniProt ID:	P35318
mRNA ID:	NM_001124
Length:	185
RefSeq Status:

`MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMN NFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL`

sig_peptide: 1..21
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P35318.1)
calculated_mol_wt: 2201
peptide sequence: 
MKLVSVALMYLGSLAFLGADT

mat_peptide: 22..41
product: Proadrenomedullin N-20 terminal peptide
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P35318.1)
calculated_mol_wt: 2462
peptide sequence: 
ARLDVASEFRKKWNKWALSR

mat_peptide: 95..146
product: adrenomedullin
experiment: DESCRIPTION:antimicrobial peptide[PMID: 10225288]
calculated_mol_wt: 6032
peptide sequence: 
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY