MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP000515

Record overview

MGPD IDMGP000515
Gene ID1030
SpeciesHomo sapiens (Human)
Gene Namecyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Gene Symbol CDKN2B
SynonymsP15; MTS2; TP15; CDK4I; INK4B; p15INK4b;
Alternate namescyclin-dependent kinase 4 inhibitor B; MTS-2; p14-INK4b; p14_INK4B; p15-INK4b; p15_INK4B; CDK4B inhibitor; p14_CDK inhibitor; p15 CDK inhibitor; CDK inhibitory protein; multiple tumor suppressor 2; cyclin-dependent kinases 4 and 6 binding protein;
Chromosome9
Map Location9p21
SummaryThis gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for CDKN2B

Proteins

cyclin-dependent kinase 4 inhibitor B isoform 1
Refseq ID:NP_004927
Protein GI:17981694
UniProt ID:P42772
mRNA ID:NM_004936
Length:138
RefSeq Status:
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLH
RAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
 
cyclin-dependent kinase 4 inhibitor B isoform 2
Refseq ID:NP_511042
Protein GI:17981696
UniProt ID:P42772
mRNA ID:NM_078487
Length:78
RefSeq Status:
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVAGAPGPRRQGARERGARPRRIGAGT
 
  logo