MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP000516

Record overview

MGPD IDMGP000516
Gene ID1031
SpeciesHomo sapiens (Human)
Gene Namecyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
Gene Symbol CDKN2C
Synonymsp18; INK4C; p18-INK4C;
Alternate namescyclin-dependent kinase 4 inhibitor C; p18-INK6; CDK6 inhibitor p18; cyclin-dependent inhibitor; cyclin-dependent kinase 6 inhibitor p18;
Chromosome1
Map Location1p32
SummaryThe protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for CDKN2C

Proteins

cyclin-dependent kinase 4 inhibitor C
Refseq ID:NP_523240
Protein GI:17981699
UniProt ID:P42773
mRNA ID:NM_078626
Length:168
RefSeq Status:
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIED
NEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
 
cyclin-dependent kinase 4 inhibitor C
Refseq ID:NP_001253
Protein GI:4502751
UniProt ID:P42773
mRNA ID:NM_001262
Length:168
RefSeq Status:
Protein sequence is identical to GI:17981699 (mRNA isoform)
 
  logo