MGP Database

MGP001044

Record overview

MGPD ID	MGP001044
Gene ID	2207
Species	Homo sapiens (Human)
Gene Name	Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
Gene Symbol	FCER1G
Synonyms	FCRG;
Alternate names	high affinity immunoglobulin epsilon receptor subunit gamma; Fc receptor gamma-chain; fc-epsilon RI-gamma; fcRgamma; fceRI gamma; immunoglobulin E receptor, high affinity, gamma chain;
Chromosome	1
Map Location	1q23
Summary	The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for FCER1G

Proteins

high affinity immunoglobulin epsilon receptor subunit gamma precursor

Refseq ID:	NP_004097
Protein GI:	4758344
UniProt ID:	P30273
mRNA ID:	NM_004106
Length:	86
RefSeq Status:

`MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ`

sig_peptide: 1..18
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 1877
peptide sequence: 
MIPAVVLLLLLLVEQAAA

mat_peptide: 19..86
product: high affinity immunoglobulin epsilon receptor subunit gamma
calculated_mol_wt: 7808
peptide sequence: 
LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ