MGP Database

MGP001336

Record overview

MGPD ID	MGP001336
Gene ID	2919
Species	Homo sapiens (Human)
Gene Name	chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
Gene Symbol	CXCL1
Synonyms	FSP; GRO1; GROa; MGSA; NAP-3; SCYB1; MGSA-a;
Alternate names	growth-regulated alpha protein; C-X-C motif chemokine 1; GRO-alpha(1-73); GRO1 oncogene (melanoma growth stimulating activity, alpha); GRO1 oncogene (melanoma growth-stimulating activity); MGSA alpha; fibroblast secretory protein; melanoma growth stimulatory activity alpha; neutrophil-activating protein 3;
Chromosome	4
Map Location	4q21
Summary	This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Sep 2014]
Orthologs	View orthologs and multiple alignments for CXCL1

Proteins

growth-regulated alpha protein precursor

Refseq ID:	NP_001502
Protein GI:	4504153
UniProt ID:	P09341
mRNA ID:	NM_001511
Length:	107
RefSeq Status:

`MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKM LNSDKSN`

sig_peptide: 1..34
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 3454
peptide sequence: 
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAG

mat_peptide: 35..107
product: growth-regulated alpha protein
experiment: DESCRIPTION:antimicrobial peptide[PMID: 12949249]
calculated_mol_wt: 7865
peptide sequence: 
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN