MGP Database

MGP001337

Record overview

MGPD ID	MGP001337
Gene ID	2920
Species	Homo sapiens (Human)
Gene Name	chemokine (C-X-C motif) ligand 2
Gene Symbol	CXCL2
Synonyms	GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a;
Alternate names	C-X-C motif chemokine 2; GRO2 oncogene; MGSA beta; MIP2-alpha; gro-beta; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta;
Chromosome	4
Map Location	4q21
Summary	This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. [provided by RefSeq, Sep 2014]
Orthologs	View orthologs and multiple alignments for CXCL2

Proteins

C-X-C motif chemokine 2 precursor

Refseq ID:	NP_002080
Protein GI:	4504155
UniProt ID:	P19875
mRNA ID:	NM_002089
Length:	107
RefSeq Status:

`MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKM LKNGKSN`

sig_peptide: 1..34
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 3514
peptide sequence: 
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAG

mat_peptide: 35..107
product: C-X-C motif chemokine 2
experiment: DESCRIPTION:antimicrobial peptide[PMID: 12949249]
calculated_mol_wt: 7892
peptide sequence: 
APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN