MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001354

Record overview

MGPD IDMGP001354
Gene ID2947
SpeciesHomo sapiens (Human)
Gene Nameglutathione S-transferase mu 3 (brain)
Gene Symbol GSTM3
SynonymsGST5; GSTB; GTM3; GSTM3-3;
Alternate namesglutathione S-transferase Mu 3; GST class-mu 3; S-(hydroxyalkyl)glutathione lyase M3; brain GST; brain type mu-glutathione S-transferase; glutathione S-alkyltransferase M3; glutathione S-aralkyltransferase M3; glutathione S-aryltransferase M3; glutathione S-transferase M3 (brain); glutathione S-transferase, Mu-3; hGSTM3-3;
Chromosome1
Map Location1p13.3
EC Number2.5.1.18
SummaryCytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Mutations of this class mu gene have been linked with a slight increase in a number of cancers, likely due to exposure with environmental toxins. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008]
OrthologsView orthologs and multiple alignments for GSTM3

Proteins

glutathione S-transferase Mu 3
Refseq ID:NP_000840
Protein GI:23065552
UniProt ID:P21266
mRNA ID:NM_000849
Length:225
RefSeq Status:
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIR
VDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAA
YLQSDQFCKMPINNKMAQWGNKPVC
 
  logo