MGP Database

MGP001632

Record overview

MGPD ID	MGP001632
Gene ID	3627
Species	Homo sapiens (Human)
Gene Name	chemokine (C-X-C motif) ligand 10
Gene Symbol	CXCL10
Synonyms	C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10;
Alternate names	C-X-C motif chemokine 10; 10 kDa interferon gamma-induced protein; gamma IP10; gamma-IP10; interferon-inducible cytokine IP-10; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; small-inducible cytokine B10;
Chromosome	4
Map Location	4q21
Summary	This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Sep 2014]
Orthologs	View orthologs and multiple alignments for CXCL10

Proteins

C-X-C motif chemokine 10 precursor

Refseq ID:	NP_001556
Protein GI:	149999382
UniProt ID:	P02778
mRNA ID:	NM_001565
Length:	98
RefSeq Status:

`MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP`

sig_peptide: 1..21
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2253
peptide sequence: 
MNQTAILICCLIFLTLSGIQG

mat_peptide: 22..98
product: C-X-C motif chemokine 10
experiment: DESCRIPTION:antimicrobial peptide[PMID: 12949249]
calculated_mol_wt: 8646
peptide sequence: 
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP