MGP Database

MGP001921

Record overview

MGPD ID	MGP001921
Gene ID	4258
Species	Homo sapiens (Human)
Gene Name	microsomal glutathione S-transferase 2
Gene Symbol	MGST2
Synonyms	GST2; MGST-II;
Alternate names	microsomal glutathione S-transferase 2; microsomal GST-2; microsomal GST-II;
Chromosome	4
Map Location	4q28.3
EC Number	2.5.1.18
Summary	The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, Feb 2011]
Orthologs	View orthologs and multiple alignments for MGST2

Proteins

microsomal glutathione S-transferase 2 isoform 1 precursor

Refseq ID:	NP_001191295
Protein GI:	324120893
UniProt ID:	Q99735
mRNA ID:	NM_001204366
Length:	147
RefSeq Status:

`MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEA AKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF`

sig_peptide: 1..23
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2359
peptide sequence: 
MAGNSILLAAVSILSACQQSYFA

sig_peptide: 1..23
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2359
peptide sequence: 
MAGNSILLAAVSILSACQQSYFA

sig_peptide: 1..23
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2359
peptide sequence: 
MAGNSILLAAVSILSACQQSYFA

microsomal glutathione S-transferase 2 isoform 1 precursor

Refseq ID:	NP_002404
Protein GI:	4505181
UniProt ID:	Q99735
mRNA ID:	NM_002413
Length:	147
RefSeq Status:

Protein sequence is identical to GI:324120893 (mRNA isoform)

sig_peptide: 1..23
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2359
peptide sequence: 
MAGNSILLAAVSILSACQQSYFA

sig_peptide: 1..23
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2359
peptide sequence: 
MAGNSILLAAVSILSACQQSYFA

microsomal glutathione S-transferase 2 isoform 2

Refseq ID:	NP_001191296
Protein GI:	324120896
UniProt ID:
mRNA ID:	NM_001204367
Length:	79
RefSeq Status:

microsomal glutathione S-transferase 2 isoform 3 precursor
`MAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF`

Refseq ID:	NP_001191297
Protein GI:	324120898
UniProt ID:	Q99735
mRNA ID:	NM_001204368
Length:	77
RefSeq Status:

`MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAHFCYLSGSGVHIWPSPILLGIFRSC`

`sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2359 peptide sequence: MAGNSILLAAVSILSACQQSYFA`