MGP Database

MGP002778

Record overview

MGPD ID	MGP002778
Gene ID	6352
Species	Homo sapiens (Human)
Gene Name	chemokine (C-C motif) ligand 5
Gene Symbol	CCL5
Synonyms	SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta;
Alternate names	C-C motif chemokine 5; T-cell specific protein p288; beta-chemokine RANTES; eosinophil chemotactic cytokine; regulated upon activation, normally T-expressed, and presumably secreted; small inducible cytokine subfamily A (Cys-Cys), member 5;
Chromosome	17
Map Location	17q12
Summary	This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]
Orthologs	View orthologs and multiple alignments for CCL5

Proteins

C-C motif chemokine 5 isoform 1 precursor

Refseq ID:	NP_002976
Protein GI:	22538814
UniProt ID:	P13501
mRNA ID:	NM_002985
Length:	91
RefSeq Status:

`MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS`

sig_peptide: 1..23
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2157
peptide sequence: 
MKVSAAALAVILIATALCAPASA

sig_peptide: 1..23
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2157
peptide sequence: 
MKVSAAALAVILIATALCAPASA

mat_peptide: 24..91
product: C-C motif chemokine 5
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P13501.3)
calculated_mol_wt: 7851
peptide sequence: 
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

mat_peptide: 26..91
product: RANTES(3-68)
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P13501.3)
calculated_mol_wt: 7667
peptide sequence: 
YSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

mat_peptide: 27..91
product: RANTES(4-68)
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P13501.3)
calculated_mol_wt: 7504
peptide sequence: 
SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

C-C motif chemokine 5 isoform 2 precursor

Refseq ID:	NP_001265665
Protein GI:	524563423
UniProt ID:
mRNA ID:	NM_001278736
Length:	154
RefSeq Status:

`MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVHRSRMPKREGQQVWQDFLYDSRLNKGKLCHPKEPPSV CQPREEMGSGVHQLFGDELGWRVLEPELTQICLFLLALVLAWEASPHYPTPPAP`

`sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2157 peptide sequence: MKVSAAALAVILIATALCAPASA`