MGP Database

MGP003137

Record overview

MGPD ID	MGP003137
Gene ID	7077
Species	Homo sapiens (Human)
Gene Name	TIMP metallopeptidase inhibitor 2
Gene Symbol	TIMP2
Synonyms	DDC8; CSC-21K;
Alternate names	metalloproteinase inhibitor 2; tissue inhibitor of metalloproteinases 2;
Chromosome	17
Map Location	17q25
Summary	This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for TIMP2

Proteins

metalloproteinase inhibitor 2 precursor

Refseq ID:	NP_003246
Protein GI:	4507511
UniProt ID:	P16035
mRNA ID:	NM_003255
Length:	220
RefSeq Status:

`MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGV SLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGS CAWYRGAAPPKQEFLDIEDP`

sig_peptide: 1..26
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2662
peptide sequence: 
MGAAARTLRLALGLLLLATLLRPADA

mat_peptide: 27..220
product: metalloproteinase inhibitor 2
calculated_mol_wt: 21755
peptide sequence: 
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITL
CDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP