MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003338

Record overview

MGPD IDMGP003338
Gene ID7531
SpeciesHomo sapiens (Human)
Gene Nametyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon
Gene Symbol YWHAE
SynonymsMDS; HEL2; MDCR; KCIP-1; 14-3-3E;
Alternate names14-3-3 protein epsilon; 14-3-3 epsilon; epididymis luminal protein 2; mitochondrial import stimulation factor L subunit; protein kinase C inhibitor protein-1; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide;
Chromosome17
Map Location17p13.3
SummaryThis gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene. [provided by RefSeq, Aug 2008]
OrthologsView orthologs and multiple alignments for YWHAE

Proteins

14-3-3 protein epsilon
Refseq ID:NP_006752
Protein GI:5803225
UniProt ID:P62258
mRNA ID:NM_006761
Length:255
RefSeq Status:
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDI
LDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFD
DAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
 
  logo