MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003712

Record overview

MGPD IDMGP003712
Gene ID8835
SpeciesHomo sapiens (Human)
Gene Namesuppressor of cytokine signaling 2
Gene Symbol SOCS2
SynonymsCIS2; SSI2; Cish2; SSI-2; SOCS-2; STATI2;
Alternate namessuppressor of cytokine signaling 2; CIS-2; STAT induced STAT inhibitor-2; STAT-induced STAT inhibitor 2; STAT-induced STAT inhibitor-2; cytokine-inducible SH2 protein 2; suppressor of cytokine signaling-2;
Chromosome12
Map Location12q
SummaryThis gene encodes a member of the suppressor of cytokine signaling (SOCS) family. SOCS family members are cytokine-inducible negative regulators of cytokine receptor signaling via the Janus kinase/signal transducer and activation of transcription pathway (the JAK/STAT pathway). SOCS family proteins interact with major molecules of signaling complexes to block further signal transduction, in part, by proteasomal depletion of receptors or signal-transducing proteins via ubiquitination. The expression of this gene can be induced by a subset of cytokines, including erythropoietin, GM-CSF, IL10, interferon (IFN)-gamma and by cytokine receptors such as growth horomone receptor. The protein encoded by this gene interacts with the cytoplasmic domain of insulin-like growth factor-1 receptor (IGF1R) and is thought to be involved in the regulation of IGF1R mediated cell signaling. This gene has pseudogenes on chromosomes 20 and 22. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]
OrthologsView orthologs and multiple alignments for SOCS2

Proteins

suppressor of cytokine signaling 2
Refseq ID:NP_001257396
Protein GI:394582051
UniProt ID:O14508
mRNA ID:NM_001270467
Length:198
RefSeq Status:
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQ
DGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
 
suppressor of cytokine signaling 2
Refseq ID:NP_003868
Protein GI:4507263
UniProt ID:O14508
mRNA ID:NM_003877
Length:198
RefSeq Status:
Protein sequence is identical to GI:394582051 (mRNA isoform)
 
suppressor of cytokine signaling 2
Refseq ID:NP_001257400
Protein GI:394582088
UniProt ID:O14508
mRNA ID:NM_001270471
Length:198
RefSeq Status:
Protein sequence is identical to GI:394582051 (mRNA isoform)
 
suppressor of cytokine signaling 2
Refseq ID:NP_001257399
Protein GI:394582079
UniProt ID:O14508
mRNA ID:NM_001270470
Length:198
RefSeq Status:
Protein sequence is identical to GI:394582051 (mRNA isoform)
 
suppressor of cytokine signaling 2
Refseq ID:NP_001257398
Protein GI:394582068
UniProt ID:O14508
mRNA ID:NM_001270469
Length:198
RefSeq Status:
Protein sequence is identical to GI:394582051 (mRNA isoform)
 
suppressor of cytokine signaling 2
Refseq ID:NP_001257397
Protein GI:394582059
UniProt ID:O14508
mRNA ID:NM_001270468
Length:198
RefSeq Status:
Protein sequence is identical to GI:394582051 (mRNA isoform)
 
  logo