MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003941

Record overview

MGPD IDMGP003941
Gene ID9536
SpeciesHomo sapiens (Human)
Gene Nameprostaglandin E synthase
Gene Symbol PTGES
SynonymsPGES; MPGES; PIG12; PP102; PP1294; MGST-IV; MGST1L1; TP53I12; mPGES-1; MGST1-L1;
Alternate namesprostaglandin E synthase; MGST1-like 1; glutathione S-transferase 1-like 1; microsomal glutathione S-transferase 1-like 1; microsomal prostaglandin E synthase 1; microsomal prostaglandin E synthase-1; p53-induced apoptosis protein 12; p53-induced gene 12 protein; tumor protein p53 inducible protein 12;
Chromosome9
Map Location9q34.3
EC Number5.3.99.3
SummaryThe protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for PTGES

Proteins

prostaglandin E synthase
Refseq ID:NP_004869
Protein GI:4758910
UniProt ID:O14684
mRNA ID:NM_004878
Length:152
RefSeq Status:
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAW
MHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
 
  logo